General Information

  • ID:  hor006450
  • Uniprot ID:  P83964
  • Protein name:  Atrial natriuretic factor
  • Gene name:  nppa
  • Organism:  Acipenser transmontanus (White sturgeon)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  Expressed in heart atrium and to a lower extent in heart ventricle, but not in brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Acipenser (genus), Acipenserini (tribe), Acipenserinae (subfamily), Acipenseridae (family), Acipenseroidei (suborder), Acipenseriformes (order), Chondrostei (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NNRGSSGCFGSRIDRIGSMSSMGCGGSRKG
  • Length:  30(113-142)
  • Propeptide:  MMLKTVIYTGVLFLICNKVLVRADPLYSPYSSKDLANLKTLLERFEDTLGQDEGNDNQQDYDIANPEAEGPQAGSPWDRERERQWPASDYKKPQEGYQSQSSRLRDLLMAPRNNRGSSGCFGSRIDRIGSMSSMGCGGSRKG
  • Signal peptide:  MMLKTVIYTGVLFLICNKVLVRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Has a cGMP-stimulating activity (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45893
  • Structure ID:  AF-P83964-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006450_AF2.pdbhor006450_ESM.pdb

Physical Information

Mass: 353978 Formula: C116H197N45O42S4
Absent amino acids: AEHLPQTVWY Common amino acids: G
pI: 11.31 Basic residues: 5
Polar residues: 19 Hydrophobic residues: 3
Hydrophobicity: -68.67 Boman Index: -8343
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 26
Instability Index: 4593.33 Extinction Coefficient cystines: 125
Absorbance 280nm: 4.31

Literature

  • PubMed ID:  15072558
  • Title:  Four natriuretic peptides (ANP, BNP, VNP and CNP) coexist in the sturgeon: identification of BNP in fish lineage.